Products

HMGB1 (High mobility group box 1), Human

HMGB1 is present in the nuclei (chromatin associated) and cytoplasm of all cells and is a highly conserved protein in variety of species that. In the cytoplasm, HMGB1 is a regulator of autophagy, enhances cell survival, and limits apoptosis. It also can reduces protein aggregation caused by heat or chemical stress. HMGB1 is released to the extracellular milieu by inflammatory cells and by necrotic and apoptotic cells. Once released, it works as an inflammatory cytokine.HMGB1 is also secreted by macrophages and monocytes as a late response to LPS, TNF-α, IL-1β, or IFN-γ.
No. Size Price Qty Status
C01082-5UG 5 ug $108.00 Inquiry
C01082-20UG 20 ug $268.00 Inquiry
C01082-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKD
PNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKK
KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE with polyhistidine tag at the C-terminus

UnitProt ID:
P09429
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce TNF alpha in RAW264.7 cells. The ED50 for this effect is <10 μg/mL.
 
Purity:
>98% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for HMGB1 (High mobility group box 1), Human

Average Rating: 0 (0 Reviews )